Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species) |
Species Streptococcus pyogenes [TaxId:1314] [141928] (2 PDB entries) Uniprot Q9A1S9 1-152 |
Domain d2ahra2: 2ahr A:1-152 [126776] Other proteins in same PDB: d2ahra1, d2ahra3, d2ahrb1, d2ahrb3, d2ahrc1, d2ahrd1, d2ahrd3, d2ahre1, d2ahre3 complexed with fmt, na, nap |
PDB Entry: 2ahr (more details), 2.15 Å
SCOPe Domain Sequences for d2ahra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdl vilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqss taltgnalvsqelqarvrdltdsfgstfdise
Timeline for d2ahra2: