Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins) similar dimer to the class I KARI |
Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species) |
Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries) Uniprot Q9A1S9 153-256 |
Domain d2ahra1: 2ahr A:153-256 [126775] Other proteins in same PDB: d2ahra2, d2ahrb2, d2ahrc2, d2ahrd2, d2ahre2 complexed with fmt, na, nap |
PDB Entry: 2ahr (more details), 2.15 Å
SCOP Domain Sequences for d2ahra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahra1 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp hdfidaicspggttiaglmelerlgltatvssaidktidkaksl
Timeline for d2ahra1: