Lineage for d2ahra1 (2ahr A:153-256)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721489Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
    similar dimer to the class I KARI
  6. 2721493Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)
  7. 2721498Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries)
    Uniprot Q9A1S9 153-256
  8. 2721499Domain d2ahra1: 2ahr A:153-256 [126775]
    Other proteins in same PDB: d2ahra2, d2ahra3, d2ahrb2, d2ahrb3, d2ahrc2, d2ahrd2, d2ahrd3, d2ahre2, d2ahre3
    complexed with fmt, na, nap

Details for d2ahra1

PDB Entry: 2ahr (more details), 2.15 Å

PDB Description: crystal structures of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes
PDB Compounds: (A:) putative pyrroline carboxylate reductase

SCOPe Domain Sequences for d2ahra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahra1 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp
hdfidaicspggttiaglmelerlgltatvssaidktidkaksl

SCOPe Domain Coordinates for d2ahra1:

Click to download the PDB-style file with coordinates for d2ahra1.
(The format of our PDB-style files is described here.)

Timeline for d2ahra1: