Lineage for d2ahpb1 (2ahp B:1-32)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752378Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 752379Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 752439Protein GCN4 [57961] (1 species)
  7. 752440Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (58 PDB entries)
  8. 752459Domain d2ahpb1: 2ahp B:1-32 [126774]
    automatically matched to 2AHP A:1-33

Details for d2ahpb1

PDB Entry: 2ahp (more details), 2 Å

PDB Description: GCN4 leucine zipper, mutation of Lys15 to epsilon-azido-Lys
PDB Compounds: (B:) General control protein GCN4

SCOP Domain Sequences for d2ahpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahpb1 h.1.3.1 (B:1-32) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellkknyhlenevarlkklvge

SCOP Domain Coordinates for d2ahpb1:

Click to download the PDB-style file with coordinates for d2ahpb1.
(The format of our PDB-style files is described here.)

Timeline for d2ahpb1:

752459
d2ahpb1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2ahpa1