![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.3: Leucine zipper domain [57959] (2 families) ![]() |
![]() | Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
![]() | Protein GCN4 [57961] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries) Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
![]() | Domain d2ahpb1: 2ahp B:1-32 [126774] automatically matched to 2AHP A:1-33 mutant |
PDB Entry: 2ahp (more details), 2 Å
SCOPe Domain Sequences for d2ahpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahpb1 h.1.3.1 (B:1-32) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} rmkqledkveellkknyhlenevarlkklvge
Timeline for d2ahpb1: