Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (2 families) |
Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
Protein GCN4 [57961] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries) Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
Domain d2ahpa1: 2ahp A:1-33 [126773] mutant |
PDB Entry: 2ahp (more details), 2 Å
SCOPe Domain Sequences for d2ahpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahpa1 h.1.3.1 (A:1-33) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} rmkqledkveellkknyhlenevarlkklvger
Timeline for d2ahpa1: