SCOPe 2.08: Domain d2ahpa1: 2ahp A:1-33

Lineage for d2ahpa1 (2ahp A:1-33)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (2 families)

5. Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)

6. Protein GCN4 [57961] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
   Uniprot P03069 249-279 ! Uniprot P03069 249-281

8. Domain d2ahpa1: 2ahp A:1-33 [126773]
   mutant

Details for d2ahpa1

PDB Entry: 2ahp, 2 Å

PDB Description: GCN4 leucine zipper, mutation of Lys15 to epsilon-azido-Lys

PDB Compounds: (A:) General control protein GCN4

SCOPe Domain Sequences for d2ahpa1:

Sequence; same for both SEQRES and ATOM records:

>d2ahpa1 h.1.3.1 (A:1-33) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellkknyhlenevarlkklvger

Timeline for d2ahpa1:

• d2ahpa1 first appeared in SCOP 1.73
  
• d2ahpa1 appears in SCOPe 2.07