SCOP 1.75: Domain d2ahob1: 2aho B:85-175

Lineage for d2ahob1 (2aho B:85-175)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.14: eIF2alpha middle domain-like [116742] (1 family)

5. Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)

6. Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [140651] (1 PDB entry)
   Uniprot Q97Z79 85-175

8. Domain d2ahob1: 2aho B:85-175 [126770]
   Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob2, d2ahob3
   complexed with gnp, mg, zn

Details for d2ahob1

PDB Entry: 2aho, 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp

PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOP Domain Sequences for d2ahob1:

Sequence; same for both SEQRES and ATOM records:

>d2ahob1 a.60.14.1 (B:85-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]}
vtdderrkknlqwkkiqrldkilelvsqklklsekdaweqvawkleakygdpitaiekav
kegekilidagvpeiwvkplleeaskhaeer

Timeline for d2ahob1:

• d2ahob1 first appeared in SCOP 1.73
  
• d2ahob1 appears in SCOPe 2.01
  
• d2ahob1 appears in the current release, SCOPe 2.08