Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.14: eIF2alpha middle domain-like [116742] (1 family) |
Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein) |
Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [140651] (1 PDB entry) |
Domain d2ahob1: 2aho B:85-175 [126770] Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob2, d2ahob3 complexed with gnp, mg, zn |
PDB Entry: 2aho (more details), 3 Å
SCOP Domain Sequences for d2ahob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahob1 a.60.14.1 (B:85-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]} vtdderrkknlqwkkiqrldkilelvsqklklsekdaweqvawkleakygdpitaiekav kegekilidagvpeiwvkplleeaskhaeer
Timeline for d2ahob1: