Lineage for d2ahoa2 (2aho A:321-415)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952593Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952594Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 952595Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 952671Protein Initiation factor eIF2 gamma subunit [74964] (3 species)
  7. 952680Species Sulfolobus solfataricus [TaxId:2287] [141344] (5 PDB entries)
    Uniprot Q980A5 321-415
  8. 952685Domain d2ahoa2: 2aho A:321-415 [126768]
    Other proteins in same PDB: d2ahoa1, d2ahoa3, d2ahob1, d2ahob2, d2ahob3
    complexed with gnp, mg, zn

Details for d2ahoa2

PDB Entry: 2aho (more details), 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2ahoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahoa2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d2ahoa2:

Click to download the PDB-style file with coordinates for d2ahoa2.
(The format of our PDB-style files is described here.)

Timeline for d2ahoa2: