Lineage for d2ahmh1 (2ahm H:43-197)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616181Fold d.302: Coronavirus NSP8-like [143075] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(4)-alpha-beta; bifurcated barrel-like beta-sheet
  4. 2616182Superfamily d.302.1: Coronavirus NSP8-like [143076] (1 family) (S)
    automatically mapped to Pfam PF08717
  5. 2616183Family d.302.1.1: Coronavirus NSP8-like [143077] (2 proteins)
  6. 2616184Protein Nonstructural protein 8, NSP8 [143078] (1 species)
    contains extra N-terminal helical regions involved in heterooligomerisation with NSP7
  7. 2616185Species SARS coronavirus [TaxId:227859] [143079] (1 PDB entry)
    Uniprot P59641 3961-4111
  8. 2616189Domain d2ahmh1: 2ahm H:43-197 [126766]
    Other proteins in same PDB: d2ahma1, d2ahma2, d2ahmb2, d2ahmb3, d2ahmc2, d2ahmc3, d2ahmd2, d2ahmd3
    automatically matched to 2AHM E:43-197
    complexed with gol, so4

Details for d2ahmh1

PDB Entry: 2ahm (more details), 2.4 Å

PDB Description: Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer
PDB Compounds: (H:) Replicase polyprotein 1ab, heavy chain

SCOPe Domain Sequences for d2ahmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahmh1 d.302.1.1 (H:43-197) Nonstructural protein 8, NSP8 {SARS coronavirus [TaxId: 227859]}
lkkslnvaksefdrdaamqrklekmadqamtqmykqarsedkrakvtsamqtmlftmlrk
ldndalnniinnardgcvplniiplttaaklmvvvpdygtykntcdgntftyasalweiq
qvvdadskivqlseinmdnspnlawplivtalran

SCOPe Domain Coordinates for d2ahmh1:

Click to download the PDB-style file with coordinates for d2ahmh1.
(The format of our PDB-style files is described here.)

Timeline for d2ahmh1: