| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.302: Coronavirus NSP8-like [143075] (1 superfamily) core: alpha-beta(2)-alpha-beta(4)-alpha-beta; bifurcated barrel-like beta-sheet |
Superfamily d.302.1: Coronavirus NSP8-like [143076] (1 family) ![]() |
| Family d.302.1.1: Coronavirus NSP8-like [143077] (1 protein) |
| Protein Nonstructural protein 8, NSP8 [143078] (1 species) contains extra N-terminal helical regions involved in heterooligomerisation with NSP7 |
| Species SARS coronavirus [TaxId:227859] [143079] (1 PDB entry) |
| Domain d2ahmh1: 2ahm H:43-197 [126766] Other proteins in same PDB: d2ahma1, d2ahmb1, d2ahmc1, d2ahmd1 automatically matched to 2AHM E:43-197 complexed with gol, so4 |
PDB Entry: 2ahm (more details), 2.4 Å
SCOP Domain Sequences for d2ahmh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahmh1 d.302.1.1 (H:43-197) Nonstructural protein 8, NSP8 {SARS coronavirus [TaxId: 227859]}
lkkslnvaksefdrdaamqrklekmadqamtqmykqarsedkrakvtsamqtmlftmlrk
ldndalnniinnardgcvplniiplttaaklmvvvpdygtykntcdgntftyasalweiq
qvvdadskivqlseinmdnspnlawplivtalran
Timeline for d2ahmh1: