SCOPe 2.08: Domain d2ahid_: 2ahi D:

Lineage for d2ahid_ (2ahi D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d2ahid_: 2ahi D: [126759]
   automated match to d1gzha_
   protein/DNA complex; complexed with zn

Details for d2ahid_

PDB Entry: 2ahi, 1.85 Å

PDB Description: structural basis of dna recognition by p53 tetramers (complex iii)

PDB Compounds: (D:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2ahid_:

Sequence; same for both SEQRES and ATOM records:

>d2ahid_ b.2.5.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenlrk

Timeline for d2ahid_:

• d2ahid_ first appeared in SCOP 1.73, called d2ahid1
  
• d2ahid_ appears in SCOPe 2.07