SCOPe 2.06: Domain d2ahdd_: 2ahd D:

Lineage for d2ahdd_ (2ahd D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein automated matches [254477] (2 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [255030] (1 PDB entry)

8. Domain d2ahdd_: 2ahd D: [126755]
   automated match to d1s3la_

Details for d2ahdd_

PDB Entry: 2ahd, 3 Å

PDB Description: The Apo structure of Methanococcus jannaschii phosphodiesterase MJ0936

PDB Compounds: (D:) Phosphodiesterase MJ0936

SCOPe Domain Sequences for d2ahdd_:

Sequence; same for both SEQRES and ATOM records:

>d2ahdd_ d.159.1.7 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

Timeline for d2ahdd_:

• d2ahdd_ first appeared in SCOP 1.73, called d2ahdd1
  
• d2ahdd_ appears in SCOPe 2.05
  
• d2ahdd_ appears in SCOPe 2.07
  
• d2ahdd_ appears in the current release, SCOPe 2.08