Lineage for d2ahdd_ (2ahd D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938484Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 1938517Protein automated matches [254477] (1 species)
    not a true protein
  7. 1938518Species Methanocaldococcus jannaschii [TaxId:2190] [255030] (1 PDB entry)
  8. 1938522Domain d2ahdd_: 2ahd D: [126755]
    automated match to d1s3la_

Details for d2ahdd_

PDB Entry: 2ahd (more details), 3 Å

PDB Description: The Apo structure of Methanococcus jannaschii phosphodiesterase MJ0936
PDB Compounds: (D:) Phosphodiesterase MJ0936

SCOPe Domain Sequences for d2ahdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahdd_ d.159.1.7 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

SCOPe Domain Coordinates for d2ahdd_:

Click to download the PDB-style file with coordinates for d2ahdd_.
(The format of our PDB-style files is described here.)

Timeline for d2ahdd_: