![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.7: YfcE-like [111233] (5 proteins) |
![]() | Protein automated matches [254477] (1 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [255030] (1 PDB entry) |
![]() | Domain d2ahdc_: 2ahd C: [126754] automated match to d1s3la_ |
PDB Entry: 2ahd (more details), 3 Å
SCOPe Domain Sequences for d2ahdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahdc_ d.159.1.7 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl
Timeline for d2ahdc_: