SCOP 1.73: Domain d2ahdb1: 2ahd B:201-365

Lineage for d2ahdb1 (2ahd B:201-365)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (3 proteins)

6. Protein Putative phosphodiesterase MJ0936 [111234] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [111235] (4 PDB entries)

8. Domain d2ahdb1: 2ahd B:201-365 [126753]
   automatically matched to d1s3la_

Details for d2ahdb1

PDB Entry: 2ahd, 3 Å

PDB Description: The Apo structure of Methanococcus jannaschii phosphodiesterase MJ0936

PDB Compounds: (B:) Phosphodiesterase MJ0936

SCOP Domain Sequences for d2ahdb1:

Sequence; same for both SEQRES and ATOM records:

>d2ahdb1 d.159.1.7 (B:201-365) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

Timeline for d2ahdb1:

• d2ahdb1 is new in SCOP 1.73
  
• d2ahdb1 appears in SCOP 1.75
  
• d2ahdb1 appears in the current release, SCOPe 2.08, called d2ahdb_