SCOPe 2.07: Domain d2ahcb_: 2ahc B:

Lineage for d2ahcb_ (2ahc B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (4 families)

5. Family d.190.1.1: Chorismate lyase [64289] (1 protein)
   automatically mapped to Pfam PF04345

6. Protein Chorismate lyase [64290] (1 species)

7. Species Escherichia coli [TaxId:562] [64291] (7 PDB entries)
   Uniprot P26602

8. Domain d2ahcb_: 2ahc B: [126749]
   automated match to d1fw9a_
   complexed with vnl

Details for d2ahcb_

PDB Entry: 2ahc, 2.4 Å

PDB Description: chorismate lyase with inhibitor vanilate

PDB Compounds: (B:) chorismate lyase

SCOPe Domain Sequences for d2ahcb_:

Sequence; same for both SEQRES and ATOM records:

>d2ahcb_ d.190.1.1 (B:) Chorismate lyase {Escherichia coli [TaxId: 562]}
shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei
peelpllpkesrywlreillsadgepwlagrtvvpvstlsgpelalqklgktplgrylft
sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply

Timeline for d2ahcb_:

• d2ahcb_ first appeared in SCOP 1.73, called d2ahcb1
  
• d2ahcb_ appears in SCOPe 2.06
  
• d2ahcb_ appears in the current release, SCOPe 2.08