SCOP 1.73: Domain d2ahcb1: 2ahc B:1-164

Lineage for d2ahcb1 (2ahc B:1-164)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (2 families)

5. Family d.190.1.1: Chorismate lyase [64289] (1 protein)

6. Protein Chorismate lyase [64290] (1 species)

7. Species Escherichia coli [TaxId:562] [64291] (7 PDB entries)

8. Domain d2ahcb1: 2ahc B:1-164 [126749]
   automatically matched to d1fw9a_
   complexed with vnl; mutant

Details for d2ahcb1

PDB Entry: 2ahc, 2.4 Å

PDB Description: chorismate lyase with inhibitor vanilate

PDB Compounds: (B:) chorismate lyase

SCOP Domain Sequences for d2ahcb1:

Sequence; same for both SEQRES and ATOM records:

>d2ahcb1 d.190.1.1 (B:1-164) Chorismate lyase {Escherichia coli [TaxId: 562]}
shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei
peelpllpkesrywlreillsadgepwlagrtvvpvstlsgpelalqklgktplgrylft
sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply

Timeline for d2ahcb1:

• d2ahcb1 is new in SCOP 1.73
  
• d2ahcb1 appears in SCOP 1.75
  
• d2ahcb1 appears in the current release, SCOPe 2.08, called d2ahcb_