Lineage for d2ahbb1 (2ahb B:1-184)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711668Family c.95.1.2: Chalcone synthase-like [53914] (8 protein domains)
  6. 711771Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 711799Species Mycobacterium tuberculosis [TaxId:1773] [64196] (6 PDB entries)
  8. 711806Domain d2ahbb1: 2ahb B:1-184 [126746]
    automatically matched to d1hzpa1
    mutant

Details for d2ahbb1

PDB Entry: 2ahb (more details), 2 Å

PDB Description: x-ray crystal structure of r46a,r161a mutant of mycobacterium tuberculosis fabh
PDB Compounds: (B:) Beta- ketoacyl-ACP synthase III

SCOP Domain Sequences for d2ahbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahbb1 c.95.1.2 (B:1-184) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytatgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydagncfifadgaaavvvgetp
fqgi

SCOP Domain Coordinates for d2ahbb1:

Click to download the PDB-style file with coordinates for d2ahbb1.
(The format of our PDB-style files is described here.)

Timeline for d2ahbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ahbb2