SCOP 1.73: Domain d2ah5a1: 2ah5 A:1-210

Lineage for d2ah5a1 (2ah5 A:1-210)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (9 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein predicted phosphatase SP0104 [142145] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [142146] (1 PDB entry)

8. Domain d2ah5a1: 2ah5 A:1-210 [126742]

Details for d2ah5a1

PDB Entry: 2ah5, 1.74 Å

PDB Description: hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae

PDB Compounds: (A:) COG0546: Predicted phosphatases

SCOP Domain Sequences for d2ah5a1:

Sequence; same for both SEQRES and ATOM records:

>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]}
mtsitaiffdldgtlvdssigihnaftytfkelgvpspdaktirgfmgpplessfatcls
kdqiseavqiyrsyykakgiyeaqlfpqiidlleelsssyplyitttkdtstaqdmaknl
eihhffdgiygsspeaphkadvihqalqthqlapeqaiiigdtkfdmlgaretgiqklai
twgfgeqadllnyqpdyiahkplevlayfq

Timeline for d2ah5a1:

• d2ah5a1 is new in SCOP 1.73
  
• d2ah5a1 appears in SCOP 1.75
  
• d2ah5a1 appears in the current release, SCOPe 2.08