Lineage for d2ah4x1 (2ah4 X:16-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 671094Protein Trypsin(ogen) [50515] (9 species)
  7. 671095Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)
  8. 671100Domain d2ah4x1: 2ah4 X:16-245 [126741]
    automatically matched to d1tgsz_
    complexed with ca, gbs, so4

Details for d2ah4x1

PDB Entry: 2ah4 (more details), 1.13 Å

PDB Description: guanidinobenzoyl-trypsin acyl-enzyme at 1.13 a resolution
PDB Compounds: (X:) beta-trypsin

SCOP Domain Sequences for d2ah4x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ah4x1 b.47.1.2 (X:16-245) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d2ah4x1:

Click to download the PDB-style file with coordinates for d2ah4x1.
(The format of our PDB-style files is described here.)

Timeline for d2ah4x1: