Lineage for d2ah2a2 (2ah2 A:1-399)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (2 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins) 
Protein Trypanosoma sialidase [82164] (2 species) Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89371] (11 PDB entries) 
Domain d2ah2a2: 2ah2 A:1-399 [126740]
Other proteins in same PDB: d2ah2a1
automatically matched to d1ms0a2
complexed with cl, fsi, gol, ipa; mutant
Details for d2ah2a2
PDB Entry: 2ah2 (more details), 1.6 Å
PDB Description: trypanosoma cruzi trans-sialidase in complex with 2,3-difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) Trans-sialidaseSCOP Domain Sequences for d2ah2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ah2a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]}
lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
nevyslvfarlvgelriiksvlqswknwdshlssictpa
SCOP Domain Coordinates for d2ah2a2:
Click to download the PDB-style file with coordinates for d2ah2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ah2a2:
- d2ah2a2 is new in SCOP 1.73
- d2ah2a2 appears in SCOP 1.75
- d2ah2a2 appears in the current release, SCOPe 2.08
View in 3D
