Lineage for d2ah2a2 (2ah2 A:1-399)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065231Protein Trypanosoma sialidase [82164] (2 species)
  7. 2065232Species Trypanosoma cruzi [TaxId:5693] [89371] (13 PDB entries)
    Uniprot Q26966
  8. 2065233Domain d2ah2a2: 2ah2 A:1-399 [126740]
    Other proteins in same PDB: d2ah2a1
    automated match to d1ms8a2
    complexed with cl, fsi, gol, ipa

Details for d2ah2a2

PDB Entry: 2ah2 (more details), 1.6 Å

PDB Description: trypanosoma cruzi trans-sialidase in complex with 2,3-difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d2ah2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ah2a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Trypanosoma cruzi [TaxId: 5693]}
lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
nevyslvfarlvgelriiksvlqswknwdshlssictpa

SCOPe Domain Coordinates for d2ah2a2:

Click to download the PDB-style file with coordinates for d2ah2a2.
(The format of our PDB-style files is described here.)

Timeline for d2ah2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ah2a1