SCOPe 2.07: Domain d2ah2a1: 2ah2 A:409-633

Lineage for d2ah2a1 (2ah2 A:409-633)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)

6. Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)

7. Species Trypanosoma cruzi [TaxId:5693] [89271] (13 PDB entries)
   Uniprot Q26966

8. Domain d2ah2a1: 2ah2 A:409-633 [126739]
   Other proteins in same PDB: d2ah2a2
   automated match to d1ms8a1
   complexed with cl, fsi, gol, ipa

Details for d2ah2a1

PDB Entry: 2ah2, 1.6 Å

PDB Description: trypanosoma cruzi trans-sialidase in complex with 2,3-difluorosialic acid (covalent intermediate)

PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d2ah2a1:

Sequence; same for both SEQRES and ATOM records:

>d2ah2a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Trypanosoma cruzi [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahm

Timeline for d2ah2a1:

• d2ah2a1 first appeared in SCOP 1.73
  
• d2ah2a1 appears in SCOPe 2.06
  
• d2ah2a1 appears in the current release, SCOPe 2.08