Lineage for d2agsa2 (2ags A:-1-403)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326287Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1326288Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1326520Protein Trypanosoma sialidase [82164] (2 species)
  7. 1326541Species Trypanosoma rangeli [TaxId:5698] [82165] (10 PDB entries)
    Uniprot O44049 20-653
  8. 1326544Domain d2agsa2: 2ags A:-1-403 [126738]
    Other proteins in same PDB: d2agsa1
    automatically matched to d1n1sa2
    complexed with fkd, so4

Details for d2agsa2

PDB Entry: 2ags (more details), 1.7 Å

PDB Description: trypanosoma rangeli sialidase in complex with 2-keto-3-deoxy-d- glycero-d-galacto-2,3-difluoro-nononic acid (2,3-difluoro-kdn)
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2agsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agsa2 b.68.1.1 (A:-1-403) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]}
aslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryets
fdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktr
nswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefig
gvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewe
gkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegk
rvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhe
intndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

SCOPe Domain Coordinates for d2agsa2:

Click to download the PDB-style file with coordinates for d2agsa2.
(The format of our PDB-style files is described here.)

Timeline for d2agsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2agsa1