SCOP 1.73: Domain d2agsa2: 2ags A:-1-403

Lineage for d2agsa2 (2ags A:-1-403)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (2 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)

6. Protein Trypanosoma sialidase [82164] (2 species)

7. Species Trypanosoma rangeli [TaxId:5698] [82165] (10 PDB entries)

8. Domain d2agsa2: 2ags A:-1-403 [126738]
   Other proteins in same PDB: d2agsa1
   automatically matched to d1n1sa2
   complexed with fkd, so4

Details for d2agsa2

PDB Entry: 2ags, 1.7 Å

PDB Description: trypanosoma rangeli sialidase in complex with 2-keto-3-deoxy-d- glycero-d-galacto-2,3-difluoro-nononic acid (2,3-difluoro-kdn)

PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d2agsa2:

Sequence; same for both SEQRES and ATOM records:

>d2agsa2 b.68.1.1 (A:-1-403) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]}
aslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryets
fdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktr
nswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefig
gvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewe
gkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegk
rvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhe
intndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

Timeline for d2agsa2:

• d2agsa2 is new in SCOP 1.73
  
• d2agsa2 appears in SCOP 1.75
  
• d2agsa2 appears in the current release, SCOPe 2.08