Lineage for d2agsa2 (2ags A:1-403)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065364Species Trypanosoma rangeli [TaxId:5698] [255026] (3 PDB entries)
  8. 2065365Domain d2agsa2: 2ags A:1-403 [126738]
    Other proteins in same PDB: d2agsa1, d2agsa3
    automated match to d1n1ta2
    complexed with fkd, so4

Details for d2agsa2

PDB Entry: 2ags (more details), 1.7 Å

PDB Description: Trypanosoma rangeli Sialidase in Complex with 2-Keto-3-deoxy-D-glycero-D-galacto-2,3-difluoro-nononic acid (2,3-difluoro-KDN)
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2agsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agsa2 b.68.1.1 (A:1-403) automated matches {Trypanosoma rangeli [TaxId: 5698]}
lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryetsfd
nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefiggv
gaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
tndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

SCOPe Domain Coordinates for d2agsa2:

Click to download the PDB-style file with coordinates for d2agsa2.
(The format of our PDB-style files is described here.)

Timeline for d2agsa2: