SCOPe 2.08: Domain d2agpb1: 2agp B:241-341

Lineage for d2agpb1 (2agp B:241-341)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)

8. Domain d2agpb1: 2agp B:241-341 [126733]
   Other proteins in same PDB: d2agpa2, d2agpb2
   automatically matched to d1n48a1
   protein/DNA complex; complexed with ca, dgt, mg

Details for d2agpb1

PDB Entry: 2agp, 2.9 Å

PDB Description: fidelity of dpo4: effect of metal ions, nucleotide selection and pyrophosphorolysis

PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d2agpb1:

Sequence; same for both SEQRES and ATOM records:

>d2agpb1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2agpb1:

• d2agpb1 first appeared in SCOP 1.73
  
• d2agpb1 appears in SCOPe 2.07