![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
![]() | Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) ![]() |
![]() | Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
![]() | Protein DinB homolog (DBH) [100881] (3 species) |
![]() | Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries) |
![]() | Domain d2agpb1: 2agp B:241-341 [126733] Other proteins in same PDB: d2agpa2, d2agpb2 automatically matched to d1n48a1 protein/DNA complex; complexed with ca, dgt, mg |
PDB Entry: 2agp (more details), 2.9 Å
SCOPe Domain Sequences for d2agpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2agpb1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfi
Timeline for d2agpb1: