Lineage for d2agpa1 (2agp A:241-341)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008409Protein DinB homolog (DBH) [100881] (3 species)
  7. 3008418Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)
  8. 3008468Domain d2agpa1: 2agp A:241-341 [126731]
    Other proteins in same PDB: d2agpa2, d2agpb2
    automatically matched to d1n48a1
    protein/DNA complex; complexed with ca, dgt, mg

Details for d2agpa1

PDB Entry: 2agp (more details), 2.9 Å

PDB Description: fidelity of dpo4: effect of metal ions, nucleotide selection and pyrophosphorolysis
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2agpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agpa1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOPe Domain Coordinates for d2agpa1:

Click to download the PDB-style file with coordinates for d2agpa1.
(The format of our PDB-style files is described here.)

Timeline for d2agpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2agpa2