SCOPe 2.05: Domain d2agjl2: 2agj L:108-215

Lineage for d2agjl2 (2agj L:108-215)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d2agjl2: 2agj L:108-215 [126728]
   Other proteins in same PDB: d2agjh1, d2agjh2, d2agjl1
   automated match to d1dn0a2

Details for d2agjl2

PDB Entry: 2agj, 2.6 Å

PDB Description: crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody

PDB Compounds: (L:) Yvo Fab, Light Chain

SCOPe Domain Sequences for d2agjl2:

Sequence; same for both SEQRES and ATOM records:

>d2agjl2 b.1.1.2 (L:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d2agjl2:

• d2agjl2 first appeared in SCOP 1.73
  
• d2agjl2 appears in SCOPe 2.04
  
• d2agjl2 appears in SCOPe 2.06
  
• d2agjl2 appears in the current release, SCOPe 2.08