SCOPe 2.05: Domain d2agjl1: 2agj L:1-107

Lineage for d2agjl1 (2agj L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d2agjl1: 2agj L:1-107 [126727]
   Other proteins in same PDB: d2agjh1, d2agjh2, d2agjl2
   automated match to d1dn0a1

Details for d2agjl1

PDB Entry: 2agj, 2.6 Å

PDB Description: crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody

PDB Compounds: (L:) Yvo Fab, Light Chain

SCOPe Domain Sequences for d2agjl1:

Sequence; same for both SEQRES and ATOM records:

>d2agjl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasetvsndkvawyqqkpgqaprlliygassratgip
drfsgsgsgtdftlsisglepedfvvyycqqyassprtfgqgtkvei

Timeline for d2agjl1:

• d2agjl1 first appeared in SCOP 1.73
  
• d2agjl1 appears in SCOPe 2.04
  
• d2agjl1 appears in SCOPe 2.06
  
• d2agjl1 appears in the current release, SCOPe 2.08