Lineage for d2agjl1 (2agj L:1-108)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782793Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 782851Domain d2agjl1: 2agj L:1-108 [126727]
    Other proteins in same PDB: d2agjh1, d2agjh2, d2agjl2
    automatically matched to d1rhha1
    complexed with nag

Details for d2agjl1

PDB Entry: 2agj (more details), 2.6 Å

PDB Description: crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody
PDB Compounds: (L:) Yvo Fab, Light Chain

SCOP Domain Sequences for d2agjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agjl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
eivltqspgtlslspgeratlscrasetvsndkvawyqqkpgqaprlliygassratgip
drfsgsgsgtdftlsisglepedfvvyycqqyassprtfgqgtkveik

SCOP Domain Coordinates for d2agjl1:

Click to download the PDB-style file with coordinates for d2agjl1.
(The format of our PDB-style files is described here.)

Timeline for d2agjl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2agjl2