SCOPe 2.05: Domain d2aghb_: 2agh B:

Lineage for d2aghb_ (2agh B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
   3 helices; bundle, partly opened

4. Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family)
   automatically mapped to Pfam PF02172

5. Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)

6. Protein Kix domain of CBP (creb binding protein) [47042] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47043] (9 PDB entries)

8. Domain d2aghb_: 2agh B: [126725]
   automated match to d1sb0a_

Details for d2aghb_

PDB Entry: 2agh

PDB Description: structural basis for cooperative transcription factor binding to the cbp coactivator

PDB Compounds: (B:) Crebbp protein

SCOPe Domain Sequences for d2aghb_:

Sequence; same for both SEQRES and ATOM records:

>d2aghb_ a.12.1.1 (B:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

Timeline for d2aghb_:

• d2aghb_ first appeared in SCOP 1.73, called d2aghb1
  
• d2aghb_ appears in SCOPe 2.04
  
• d2aghb_ appears in SCOPe 2.06
  
• d2aghb_ appears in the current release, SCOPe 2.08