Lineage for d2aghb_ (2agh B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697639Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 2697640Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 2697641Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 2697642Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 2697643Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries)
  8. 2697653Domain d2aghb_: 2agh B: [126725]
    automated match to d1sb0a_

Details for d2aghb_

PDB Entry: 2agh (more details)

PDB Description: structural basis for cooperative transcription factor binding to the cbp coactivator
PDB Compounds: (B:) Crebbp protein

SCOPe Domain Sequences for d2aghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aghb_ a.12.1.1 (B:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d2aghb_:

Click to download the PDB-style file with coordinates for d2aghb_.
(The format of our PDB-style files is described here.)

Timeline for d2aghb_: