Class a: All alpha proteins [46456] (290 folds) |
Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily) 3 helices; bundle, partly opened |
Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) automatically mapped to Pfam PF02172 |
Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein) |
Protein Kix domain of CBP (creb binding protein) [47042] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries) |
Domain d2aghb_: 2agh B: [126725] automated match to d1sb0a_ |
PDB Entry: 2agh (more details)
SCOPe Domain Sequences for d2aghb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aghb_ a.12.1.1 (B:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]} gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans rdeyyhllaekiykiqkeleekrrsrl
Timeline for d2aghb_: