Lineage for d2ag5d1 (2ag5 D:2-245)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820016Protein Dehydrogenase/reductase SDR family member 6, DHRS6 [141894] (1 species)
    Oxidoreductase UCPA
  7. 820017Species Human (Homo sapiens) [TaxId:9606] [141895] (1 PDB entry)
    Uniprot Q9BUT1 1-245
  8. 820021Domain d2ag5d1: 2ag5 D:2-245 [126722]
    automatically matched to 2AG5 A:1-245
    complexed with nad, so4

Details for d2ag5d1

PDB Entry: 2ag5 (more details), 1.84 Å

PDB Description: Crystal Structure of Human DHRS6
PDB Compounds: (D:) dehydrogenase/reductase (SDR family) member 6

SCOP Domain Sequences for d2ag5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ag5d1 c.2.1.2 (D:2-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]}
grldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvtk
kkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkml
aqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtvd
tpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviidg
gwsl

SCOP Domain Coordinates for d2ag5d1:

Click to download the PDB-style file with coordinates for d2ag5d1.
(The format of our PDB-style files is described here.)

Timeline for d2ag5d1: