Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein) part of Pfam PF04389 |
Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (1 species) Glutaminyl cyclase |
Species Human (Homo sapiens) [TaxId:9606] [142534] (7 PDB entries) |
Domain d2afsb1: 2afs B:33-361 [126703] automatically matched to 2AFS A:33-361 complexed with so4, zn; mutant |
PDB Entry: 2afs (more details), 2.22 Å
SCOP Domain Sequences for d2afsb1:
Sequence, based on SEQRES records: (download)
>d2afsb1 c.56.5.8 (B:33-361) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} asawpeeknyhqpailnssalwqiaegtsisemwqndlqpllierypgspgsyaarqhim qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm ddneenldestidnlnkilqvfvleylhl
>d2afsb1 c.56.5.8 (B:33-361) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} asawpeeknyhqpailnssalwqiaegtsisemwqndlqpllierypgspgsyaarqhim qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgeeaflhwspqdslygsrh laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen ldestidnlnkilqvfvleylhl
Timeline for d2afsb1: