Lineage for d2afja1 (2afj A:12-224)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664325Family b.29.1.22: SPRY domain [141154] (3 proteins)
    Pfam PF00622
  6. 664335Protein SPRY domain-containing SOCS box protein 2 [141159] (1 species)
  7. 664336Species Mouse (Mus musculus) [TaxId:10090] [141160] (1 PDB entry)
  8. 664337Domain d2afja1: 2afj A:12-224 [126693]

Details for d2afja1

PDB Entry: 2afj (more details)

PDB Description: spry domain-containing socs box protein 2 (ssb-2)
PDB Compounds: (A:) gene rich cluster, C9 gene

SCOP Domain Sequences for d2afja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
stptsqalysdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpv
aqstdgvrgkrgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnsesw
gwdigrgklyhqskgleapqypagpqgeqlvvperllvvldmeegtlgysiggtylgpaf
rglkgrtlypsvsavwgqcqvrirymgerrvee

SCOP Domain Coordinates for d2afja1:

Click to download the PDB-style file with coordinates for d2afja1.
(The format of our PDB-style files is described here.)

Timeline for d2afja1: