Lineage for d2afij1 (2afi J:2-523)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710253Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 710285Superfamily c.92.2: "Helical backbone" metal receptor [53807] (4 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 710318Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  6. 710366Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 710367Species Azotobacter vinelandii [TaxId:354] [81397] (13 PDB entries)
  8. 710399Domain d2afij1: 2afi J:2-523 [126690]
    Other proteins in same PDB: d2afia1, d2afic1, d2afii1, d2afik1
    automatically matched to d1fp4b_
    complexed with adp, ca, cfn, clf, hca, mg, sf4

Details for d2afij1

PDB Entry: 2afi (more details), 3.1 Å

PDB Description: crystal structure of mgadp bound av2-av1 complex
PDB Compounds: (J:) Nitrogenase molybdenum-iron protein

SCOP Domain Sequences for d2afij1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afij1 c.92.2.3 (J:2-523) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d2afij1:

Click to download the PDB-style file with coordinates for d2afij1.
(The format of our PDB-style files is described here.)

Timeline for d2afij1: