Lineage for d2afij_ (2afi J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912424Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2912613Protein automated matches [190199] (4 species)
    not a true protein
  7. 2912614Species Azotobacter vinelandii [TaxId:354] [186943] (14 PDB entries)
  8. 2912664Domain d2afij_: 2afi J: [126690]
    Other proteins in same PDB: d2afie_, d2afif_, d2afig_, d2afih_, d2afim_, d2afin_, d2afio_, d2afip_
    automated match to d1qh8b_
    complexed with adp, ca, cfn, clf, hca, mg, sf4

Details for d2afij_

PDB Entry: 2afi (more details), 3.1 Å

PDB Description: crystal structure of mgadp bound av2-av1 complex
PDB Compounds: (J:) Nitrogenase molybdenum-iron protein

SCOPe Domain Sequences for d2afij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afij_ c.92.2.3 (J:) automated matches {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d2afij_:

Click to download the PDB-style file with coordinates for d2afij_.
(The format of our PDB-style files is described here.)

Timeline for d2afij_: