Lineage for d2afib1 (2afi B:2-523)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1389887Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1389986Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1390040Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 1390084Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 1390085Species Azotobacter vinelandii [TaxId:354] [81397] (16 PDB entries)
  8. 1390115Domain d2afib1: 2afi B:2-523 [126686]
    Other proteins in same PDB: d2afia1, d2afic1, d2afii1, d2afik1
    automatically matched to d1fp4b_
    complexed with adp, ca, cfn, clf, hca, mg, sf4

Details for d2afib1

PDB Entry: 2afi (more details), 3.1 Å

PDB Description: crystal structure of mgadp bound av2-av1 complex
PDB Compounds: (B:) Nitrogenase molybdenum-iron protein

SCOPe Domain Sequences for d2afib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afib1 c.92.2.3 (B:2-523) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d2afib1:

Click to download the PDB-style file with coordinates for d2afib1.
(The format of our PDB-style files is described here.)

Timeline for d2afib1: