SCOP 1.73: Domain d2afhe1: 2afh E:1-289

Lineage for d2afhe1 (2afh E:1-289)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (15 PDB entries)

8. Domain d2afhe1: 2afh E:1-289 [126683]
   Other proteins in same PDB: d2afha1, d2afhb1, d2afhc1, d2afhd1
   automatically matched to d1fp6a_
   complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs

Details for d2afhe1

PDB Entry: 2afh, 2.1 Å

PDB Description: crystal structure of nucleotide-free av2-av1 complex

PDB Compounds: (E:) nitrogenase iron protein 1

SCOP Domain Sequences for d2afhe1:

Sequence; same for both SEQRES and ATOM records:

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

Timeline for d2afhe1:

• d2afhe1 is new in SCOP 1.73
  
• d2afhe1 appears in SCOP 1.75
  
• d2afhe1 appears in the current release, SCOPe 2.08, called d2afhe_