![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein Nitrogenase iron protein [52661] (2 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [52662] (15 PDB entries) |
![]() | Domain d2afhe1: 2afh E:1-289 [126683] Other proteins in same PDB: d2afha1, d2afhb1, d2afhc1, d2afhd1 automatically matched to d1fp6a_ complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs |
PDB Entry: 2afh (more details), 2.1 Å
SCOP Domain Sequences for d2afhe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
Timeline for d2afhe1: