Lineage for d2afhd1 (2afh D:2-523)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710253Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 710285Superfamily c.92.2: "Helical backbone" metal receptor [53807] (4 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 710318Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  6. 710366Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 710367Species Azotobacter vinelandii [TaxId:354] [81397] (13 PDB entries)
  8. 710373Domain d2afhd1: 2afh D:2-523 [126682]
    Other proteins in same PDB: d2afha1, d2afhc1, d2afhe1, d2afhf1
    automatically matched to d1fp4b_
    complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs

Details for d2afhd1

PDB Entry: 2afh (more details), 2.1 Å

PDB Description: Crystal Structure of Nucleotide-Free Av2-Av1 Complex
PDB Compounds: (D:) Nitrogenase molybdenum-iron protein

SCOP Domain Sequences for d2afhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afhd1 c.92.2.3 (D:2-523) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d2afhd1:

Click to download the PDB-style file with coordinates for d2afhd1.
(The format of our PDB-style files is described here.)

Timeline for d2afhd1: