| Class b: All beta proteins [48724] (174 folds) |
| Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
| Family b.26.1.2: FHA domain [49885] (12 proteins) |
| Protein Antigen ki-67 [101626] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101627] (2 PDB entries) |
| Domain d2affa1: 2aff A:3-100 [126678] automatically matched to d1r21a_ |
PDB Entry: 2aff (more details)
SCOPe Domain Sequences for d2affa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}
ptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeailhn
fsstnptqvngsvidepvrlkhgdvitiidrsfryene
Timeline for d2affa1: