Lineage for d2affa_ (2aff A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778114Protein Antigen ki-67 [101626] (1 species)
  7. 2778115Species Human (Homo sapiens) [TaxId:9606] [101627] (2 PDB entries)
  8. 2778116Domain d2affa_: 2aff A: [126678]
    automated match to d1r21a_

Details for d2affa_

PDB Entry: 2aff (more details)

PDB Description: the solution structure of the ki67fha/hnifk(226-269)3p complex
PDB Compounds: (A:) Antigen Ki-67

SCOPe Domain Sequences for d2affa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2affa_ b.26.1.2 (A:) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}
ptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeailhn
fsstnptqvngsvidepvrlkhgdvitiidrsfryene

SCOPe Domain Coordinates for d2affa_:

Click to download the PDB-style file with coordinates for d2affa_.
(The format of our PDB-style files is described here.)

Timeline for d2affa_: