SCOPe 2.08: Domain d2afcb_: 2afc B:

Lineage for d2afcb_ (2afc B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Hypothetical protein BT1257 [142545] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [142546] (1 PDB entry)
   Uniprot Q8A8B0 2-155

8. Domain d2afcb_: 2afc B: [126677]
   automated match to d2afca1

Details for d2afcb_

PDB Entry: 2afc, 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Q8A8B0 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR9.

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2afcb_:

Sequence, based on SEQRES records:

>d2afcb_ c.50.1.2 (B:) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]}
eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft
lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp
rigcglaggkwelmeqiikeelitkeiavtvydl

Sequence, based on observed residues (ATOM records):

>d2afcb_ c.50.1.2 (B:) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]}
eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft
lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp
rigcgaggkwelmeqiikeelitkeiavtvydl

Timeline for d2afcb_:

• d2afcb_ first appeared in SCOP 1.73, called d2afcb1
  
• d2afcb_ appears in SCOPe 2.07