Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein Hypothetical protein BT1257 [142545] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [142546] (1 PDB entry) Uniprot Q8A8B0 2-155 |
Domain d2afcb_: 2afc B: [126677] automated match to d2afca1 |
PDB Entry: 2afc (more details), 2.5 Å
SCOPe Domain Sequences for d2afcb_:
Sequence, based on SEQRES records: (download)
>d2afcb_ c.50.1.2 (B:) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp rigcglaggkwelmeqiikeelitkeiavtvydl
>d2afcb_ c.50.1.2 (B:) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp rigcgaggkwelmeqiikeelitkeiavtvydl
Timeline for d2afcb_: