Lineage for d2afca1 (2afc A:2-155)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120618Family c.50.1.2: Macro domain [89724] (7 protein domains)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 2120646Protein Hypothetical protein BT1257 [142545] (1 species)
  7. 2120647Species Bacteroides thetaiotaomicron [TaxId:818] [142546] (1 PDB entry)
    Uniprot Q8A8B0 2-155
  8. 2120648Domain d2afca1: 2afc A:2-155 [126676]

Details for d2afca1

PDB Entry: 2afc (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Q8A8B0 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR9.
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2afca1:

Sequence, based on SEQRES records: (download)

>d2afca1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]}
eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft
lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp
rigcglaggkwelmeqiikeelitkeiavtvydl

Sequence, based on observed residues (ATOM records): (download)

>d2afca1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]}
eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft
lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp
rigcgaggkwelmeqiikeelitkeiavtvydl

SCOPe Domain Coordinates for d2afca1:

Click to download the PDB-style file with coordinates for d2afca1.
(The format of our PDB-style files is described here.)

Timeline for d2afca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2afcb_