Lineage for d2afbb_ (2afb B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004648Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1004649Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1004650Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
  6. 1004651Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 1004652Species Thermotoga maritima, TM0067 [TaxId:2336] [75296] (1 PDB entry)
  8. 1004654Domain d2afbb_: 2afb B: [126675]
    automated match to d1j5va_
    complexed with ca, ni

Details for d2afbb_

PDB Entry: 2afb (more details), 2.05 Å

PDB Description: crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution
PDB Compounds: (B:) 2-keto-3-deoxygluconate kinase

SCOPe Domain Sequences for d2afbb_:

Sequence, based on SEQRES records: (download)

>d2afbb_ c.72.1.1 (B:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]}
hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
vmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktvgi
tlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkk
aefaaaasclkhtipgdfvvlsieeieklasg

Sequence, based on observed residues (ATOM records): (download)

>d2afbb_ c.72.1.1 (B:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]}
hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
vmipfmeyvdvlianeediekvlgisvegldnreayakiaeevtrkynfktvgitlresi
satvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaa
asclkhtipgdfvvlsieeieklasg

SCOPe Domain Coordinates for d2afbb_:

Click to download the PDB-style file with coordinates for d2afbb_.
(The format of our PDB-style files is described here.)

Timeline for d2afbb_: