Lineage for d2afae2 (2afa E:4-415)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (3 proteins)
    automatically mapped to Pfam PF07221
  6. Protein Putative NAG isomerase YihS [140788] (2 species)
  7. Species Salmonella typhimurium [TaxId:90371] [140789] (2 PDB entries)
    Uniprot Q8ZKT7 2-413
  8. Domain d2afae2: 2afa E:4-415 [126672]
    Other proteins in same PDB: d2afaa2, d2afab3, d2afac3, d2afad3, d2afae3, d2afaf3
    automated match to d2afaa1

Details for d2afae2

PDB Entry: 2afa (more details), 2.15 Å

PDB Description: crystal structure of putative nag isomerase from salmonella typhimurium
PDB Compounds: (E:) NAG isomerase

SCOPe Domain Sequences for d2afae2:

Sequence, based on SEQRES records: (download)

>d2afae2 a.102.1.3 (E:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}
kwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvys
vaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallgaa
savttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhaveaf
livydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfra
yggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvys
vdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsww
qeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldina

Sequence, based on observed residues (ATOM records): (download)

>d2afae2 a.102.1.3 (E:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}
kwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvys
vaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallgaa
savttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhaveaf
livydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfra
yggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvys
vdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsww
qeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina

SCOPe Domain Coordinates for d2afae2 are not available.

Timeline for d2afae2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2afae3
View in 3D
Domains from other chains:
(mouse over for more information)
d2afaa1, d2afaa2, d2afab2, d2afab3, d2afac2, d2afac3, d2afad2, d2afad3, d2afaf2, d2afaf3