Lineage for d2afac_ (2afa C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498424Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1498543Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (2 proteins)
    automatically mapped to Pfam PF07221
  6. 1498548Protein Putative NAG isomerase YihS [140788] (2 species)
  7. 1498556Species Salmonella typhimurium [TaxId:90371] [140789] (2 PDB entries)
    Uniprot Q8ZKT7 2-413
  8. 1498565Domain d2afac_: 2afa C: [126670]
    automated match to d2afaa1

Details for d2afac_

PDB Entry: 2afa (more details), 2.15 Å

PDB Description: Crystal Structure of putative NAG isomerase from Salmonella typhimurium
PDB Compounds: (C:) NAG isomerase

SCOPe Domain Sequences for d2afac_:

Sequence, based on SEQRES records: (download)

>d2afac_ a.102.1.3 (C:) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}
lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
wqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldina

Sequence, based on observed residues (ATOM records): (download)

>d2afac_ a.102.1.3 (C:) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}
lkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvy
svaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallga
asavttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhavea
flivydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfr
ayggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvy
svdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsw
wqeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina

SCOPe Domain Coordinates for d2afac_:

Click to download the PDB-style file with coordinates for d2afac_.
(The format of our PDB-style files is described here.)

Timeline for d2afac_: